Peptide Property Baseline (atlas-therapeutics/peptide-property-baseline)

A deterministic calculator rather than a learned model: average mass from an amino-acid sequence. It is here so the inference surface carries one endpoint whose answer anyone can check by hand.

Test this model

RegressionBaseline runner: baseline-cputhis button is freeAPI: 20 credits per 1,000 residues, minimum 1

A CPU baseline answers here, not the catalogued weights — this deployment has no inference cluster. The answers are real and deterministic, and they are not this model's.

Input53/2000

Pre-filled with this endpoint's example. Replace it with your own.

Pricing this input…

Checking your free tests…

Call it from anywhere

# Create a token at /settings/tokens with the infer:run scope.
export ATLAS_TOKEN=atlp_…

# What it costs, before spending anything. Free and unmetered, and it runs
# the same count the charge runs -- so {"units": …} is what you will pay for.
curl -sS https://demoatlas.online/atlas-therapeutics/peptide-property-baseline/infer/quote \
  -H "Authorization: Bearer $ATLAS_TOKEN" \
  -H "Content-Type: application/json" \
  -d '{"input":"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK"}'
# -> {"billingUnit":"residue","units":…,"credits":…}

curl -sS https://demoatlas.online/atlas-therapeutics/peptide-property-baseline/infer \
  -H "Authorization: Bearer $ATLAS_TOKEN" \
  -H "Content-Type: application/json" \
  -d '{"input":"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK"}'

# Batch: send {"inputs": ["…", "…"]} instead, up to 16 per call.
# Both doors take the same body, so one quote covers the batch you send.

The API door charges by the unit consumed — this endpoint counts residues — and takes a batch of up to 16 inputs; this page's button is free and takes one. The /quote call above prices any body without running it, for nothing. Create a token with the infer:run scope, then read the inference docs for the response shapes and the error codes.

atlas-therapeutics/peptide-property-baseline

Overview

Test this model